Fggy carbohydrate kinase family

Author: ewqh

August undefined, 2024

WebThe FGGY carbohydrate kinase family includes, L-fuculokinase, gluconokinase, glycerol kinase, D-ribulose kinase, and L-xylulose kinase (Omelchenko et al., 2010). ... WebJun 17, 2014 · Eight candidate genes, S100P, AKR1C3, CNN3, AKR1B1, MACC1, HBE1, TFF3, and FGGY, were selected on the basis of their remarkable overexpression in SW620 cells and unlikable to be related to inflammation (Table 1 ). We were examined these genes in tissues and LNs of 14 colorectal cancer patients and 11 controls by real-time qRT-PCR.

ZFIN Gene: gk5 - Zebrafish Information Network

WebMay 19, 2016 · Expression of FGGY is significantly lower in the red factor canary than in the yellow canary, the opposite of what one would expect for a ketolase. Furthermore, FGGY encodes a protein with homology to a family of kinases … WebCarbohydrate kinase FGGY C-terminal InterPro annotation BLAST Add Sequence: AVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACA burg pediatric dentistry

ZFIN Gene: fggy - Zebrafish Information Network

WebIrina RODIONOVA, PhD Cited by 1,411 of University of California, San Diego, California (UCSD) Read 91 publications Contact Irina RODIONOVA http://pfam-legacy.xfam.org/family/PF02782 WebThere is a very high volume of traffic coming from your site (IP address 40.79.131.210) as of Mon Apr 10 09:00:11 2024 (California time). So that other users get a fair share of our bandwidth, we are putting in a delay of 10.1 seconds before we service your request. burgpanorama wertheim

FGGY carbohydrate kinase family - Wikipedia

FGGY carbohydrate kinase domain containing is …

WebPredicted to be involved in carbohydrate phosphorylation and pentose metabolic process. Predicted to act upstream of or within carbohydrate metabolic process and phosphorylation. Predicted to be active in cytoplasm. Orthologous to human FGGY (FGGY carbohydrate kinase domain containing). Genome Resources Alliance ( 1) … WebDescription:Homo sapiens FGGY carbohydrate kinase domain containing (FGGY), transcript variant 4, mRNA. (from RefSeq NM_001278224) RefSeq Summary (NM_018291):This gene encodes a protein that phosphorylates carbohydrates such as ribulose, ribitol, and L-arabinitol. burg pediatric dentistry medicaidWebIn molecular biology the FGGY carbohydrate kinase family is a family of evolutionarily related carbohydrate kinase enzymes. These enzymes include L-fuculokinase EC 2.7.1.51 (gene fucK); gluconokinase EC 2.7.1.12 (gene gntK); glycerol kinase EC … burg pediatric dentistry stansbury park

"WebCarbohydrate kinase and ribulose-phosphate 3-epimerase fusion proteins-like; belongs to the FGGY family of carbohydrate kinases This subgroup is composed of … " - Fggy carbohydrate kinase family

Fggy carbohydrate kinase family

FGGY carbohydrate kinase domain containing is …

WebDescription: Homo sapiens glycerol kinase (GK), transcript variant 4, mRNA. RefSeq Summary (NM_001205019): The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. WebDec 22, 2011 · Here, using the FGGY carbohydrate kinase family as an example, we built a confidently annotated reference set (CARS) of proteins by propagating experimentally verified functional assignments to a …

Did you know?

WebThe three-dimensional structures of Escherichia coli glycerol kinase (GK) with bound glycerol in the presence and absence of one of the allosteric regulators of its activity, fructose 1,6-bisphosphate (FBP), at 3.2 and 3.0 Å, are presented. The molecule crystallized in space group P41212, and the structure was solved by molecular replacement. The … WebDescription: Homo sapiens FGGY carbohydrate kinase domain containing (FGGY), transcript variant 4, mRNA. (from RefSeq NM_001278224) (from RefSeq …

WebOct 20, 2024 · The Fggy gene belongs to an evolutionarily related family of carbohydrate kinases that has been found to phosphorylate an array of sugar substrates (Zhang et al., … WebThe Fggy gene belongs to an evolutionarily related family of carbohydrate kinases that has been found to phosphorylate an array of sugar substrates (Zhang et al., 2011). The …

WebDescription: Homo sapiens glycerol kinase (GK), transcript variant 3, mRNA. RefSeq Summary (NM_001128127): The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. WebPR:000029109 FGGY carbohydrate kinase domain-containing protein (term hierarchy) EC 2.7.1.47 InterPro Domains IPR043129 ATPase, nucleotide binding domain IPR000577 Carbohydrate kinase, FGGY IPR018485 Carbohydrate kinase, FGGY, C-terminal IPR018484 Carbohydrate kinase, FGGY, N-terminal IPR006003 FGGY carbohydrate …

WebThe single-nucleotide polymorphisms (SNPs) rs6700125 and rs6690993 in FGGY (FLJ10986) were recently reported to be a susceptibility factor for sporadic amyotrophic lateral sclerosis (SALS) in Caucasian populations in genome-wide association studies.However, no such association was observed in other independent genome-wide …

WebKnown substrates of FGGY kinases include several distinct sugars ranging from trioses to heptoses. This family also contains a divergent subfamily functioning in quorum sensing, which phosphorylates AI-2, a bacterial signaling molecule derived from 4,5-dihydroxy-2,3-pentanedione (DPD) [11,12]. hallows grange wettonWebThe FGGY Carbohydrate Kinase Family: Insights into the Evolution of Functional Specificities hallows gun mm2 valuehttp://pfam-legacy.xfam.org/family/PF02782#:~:text=In%20molecular%20biology%20the%20FGGY%20carbohydrate%20kinase%20family,xylB%29%3B%20and%20L-xylulose%20kinase%20EC%202.7.1.53%20%28gene%20lyxK%29. burg pediatric dentistry lone peakWebMay 16, 2024 · HGNC Approved Gene Symbol: FGGY Cytogenetic location: 1p32.1 Genomic coordinates (GRCh38): 1:59,296,378-59,762,730(from NCBI) TEXT … burg pediatric dentistry murray utahWebThe microarray revealed that Fggy carbohydrate kinase domain containing (Fggy) is expressed in skeletal muscle and is induced in response to denervation. Bioinformatic … burg pediatric dentistry tooeleWebJun 17, 2014 · FGGY encodes a member of the FGGY kinase family that acts as a phosphotransferase . In this study, we investigated whether these genes could be used as biomarkers for detecting LN metastases of CRC by qRT-PCR. ... The FGGY carbohydrate kinase family: insights into the evolution of functional specificities. PLoS Comput Biol. … hallowshack.comWebOct 2, 2024 · FGGY family of carbohydrate kinases. This family is predominantly composed of glycerol kinase (GK) and similar carbohydrate kinases including … burg pediatric dentistry north salt lake