Cyhr1

Author: xlos

August undefined, 2024

WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: … WebCYHR1 CRISPR Knockout and Activation Plasmids (m) designed to edit, knockdown or upregulate mouse CYHR1 gene expression. Choose a Store Santa cruz biotechnology. Santa Cruz Animal Health. Choose a Language English Français 日本語中文 한글 ...

lnc-CYHR1-1 Gene - GeneCards lnc-CYHR1-1 RNA Gene

WebDesaki, R., Sawada, G., Okumura, H., Ikeda, R., Tanabe, K., Komatsu, H., … Natsugoe, S. (2015). As a Novel Prognostic Marker, Cysteine/histidine-rich 1 (CYHR1) is a ... WebPrEST Antigen CYHR1 [Catalog No.: ATL-APrEST76449] Toggle menu. Compare ; Phone: 760-431-4600 / Fax: 760-431-4604; Sign in or Register; Cart 0. Search. CURRENT … de young judy chicago

CYHR1 Polyclonal Antibody (PA5-68516) - thermofisher.com

WebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … WebThis target displays homology in the following species: Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100% Target Information CYHR1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include nucleoplasm; zinc ion binding. For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization. deyoung insurance

Sci-Hub As a Novel Prognostic Marker, Cysteine/histidine-rich 1 ...

Pharos : Target Details - CYHR1

WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-66263. Tested in Western Blot (WB) and Immunocytochemistry (ICC/IF) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL). WebHuman diseases caused by Cyhr1 mutations The analysis uses data from IMPC, along with published data on other mouse mutants, in comparison to human disease reports in … church\u0027s 73WebCYHR1 (HGNC Symbol) Synonyms: CHRP, KIAA0496, MGC13010: Description: Cysteine and histidine rich 1 (HGNC Symbol) Entrez gene summary: Chromosome: 8: Cytoband: … church\\u0027s 73

"WebThe estimate of $40 million for the total cost of this program is based on an assumed 100 researchers leading 400 short courses for 6,000 other individuals.(12) These funds … " - Cyhr1

Cyhr1

WebCYHR1 Antibody. Applications: ICC/IF, WB, IHC. Reactivity: Human, Mouse. Images: 5. Clonality: Polyclonal. Conjugates: Unconjugated. WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% …

Did you know?

WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... WebPrEST Antigen CYHR1; Blocking agent and positive assay control using corresponding antibodies. Bulk and Prepack available at Sigmaaldrich.com. US EN. Applications Products Services Support. APREST89884; All Photos (1) APREST89884. PrEST Antigen CYHR1.

WebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ... WebPharos is the web interface for data collected by the Illuminating the Druggable Genome initiative. Target, disease and ligand information are collected and displayed.

WebThe deduced 311-amino acid protein has an N-terminal cysteine- and histidine-rich domain that shares similarity with metal-binding zinc finger domains in other proteins. Northern … WebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM …

Webanti-CYHR1 antibody (Cysteine/histidine-Rich 1) AA 51-100. anti-CYHR1 antibody (Cysteine/histidine-Rich 1) Middle Region. Browse Primary Antibodies and Browse …

Webse_chr se_start se_end se_id cell_id se_rank se_ele_num se_cas_value se_con_value se_gene_overlap se_gene_proximal se_gene_closest se_gene_prestige se_gene_closest_active se_snp_n de young leather crossbodyWebCYHR1 is part of cluster 35 Non-specific - Unknown function with confidence i Confidence is the fraction of times a gene was assigned to the cluster in repeated clustering, and … church\\u0027s 80dWebCYHR1. 1110031M01Rik, AU042374, Chrp. cysteine and histidine rich 1. GO Process (0) GO Function (1) GO Component (3) Gene Ontology Molecular Function. protein binding . Gene Ontology Cellular Component. cytoplasm ; nuclear envelope ; nucleoplasm . church\u0027s accountingWebDec 17, 2015 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1... deyoung machine works inchttp://www.licpathway.net/sedb/download/new/SE_bed/mm10/SE_12_0592_SE_mm10.bed church\\u0027s acoustic treatmentWebAcronym. Definition. PCHR. Palestinian Centre for Human Rights. PCHR. Personally Controlled Health Record (healthcare) PCHR. Philadelphia Commission on Human … church\u0027s 2000 shoesWebCYHR1 Gene - Somatic Mutations in Cancer Actionability v8 is now available for download Gene GRCh38 · COSMIC v97 Gene view The gene view histogram is a graphical view of … church\\u0027s 3 for 3