Chromohalobacter japonicus

Author: urfv

August undefined, 2024

WebOverall, the phenotypic, genotypic and phylogenetic results demonstrated that strain 43(T) represents a novel species within the genus Chromohalobacter. A Gram-negative, non-spore-forming, rod-shaped, motile bacterium, designated strain 43(T), was isolated from a Japanese salty food and then subjected to a polyphasic taxonomic study. Strain 43(T) is … Web>CAPGI00980 C2M4T5 OMAGroup:1132072 [Capnocytophaga gingivalis] MKKIGKNLEIKNIIIHQLLKEAGNGIVDAKSADHVLNISDREKLFLGNLDEAYYKKSEIIHGIFSGNFPKFKDLLLEYTE ...

Chromobacterium - Wikipedia

WebOverall, the phenotypic, genotypic and phylogenetic results demonstrated that strain 43(T) represents a novel species within the genus Chromohalobacter. The name … WebChromohalobacter japonicus 43 is an aerobe, mesophilic, Gram-negative bacterium that was isolated from food product. Gram-negative. motile. rod-shaped. aerobe. mesophilic. 16S sequence. Bacteria. how to set clock on the computer

Benzoate-Degrading Bacteria of the Family Halomonadaceae

WebA moderately halophilic psychrotolerant bacterium, strain N1, closely related to the species Chromohalobacter japonicus was isolated from the salt crust of a rock salt waste pile … WebFeb 1, 2010 · A total of 14 Halomonas strains were isolated from the blood of two patients and from dialysis machines of a renal care centre. The strains were Gram-negative, halophilic, motile and non-spore-forming rods. They produced cream-coloured colonies and contained Q-9 as the predominant ubiquinone and C18 : 1 ω7c and C16 : 0 as the major … WebJul 1, 2024 · However, average nucleotide highest identity values of TMW 2.2308 T to C. beijerinckii LMG 2148 T of 93.12% and 92.88% to C. japonicus CECT 7219 T demonstrate that it represents a novel species within the genus Chromohalobacter with additional strains TMW 2.2299 (96.91%) and TMW 2.2304 (96.98%). how to set clock on vizio smart tv

Chromohalobacter japonicus sp. nov., a moderately halophilic …

WebChromohalobacter japonicus sp. nov., a moderately halophilic bacterium isolated from a Japanese salty food. A Gram-negative, non-spore-forming, rod-shaped, motile … WebMar 8, 2015 · The production of halophilic enzymes, such as laccase, LiP, and MnP has been reported for some halophiles Chromohalobacter sp., Aquisalibacillus elongates, … note 10 fingerprint sensor locationWebJul 1, 2024 · However, average nucleotide highest identity values of TMW 2.2308 T to C. beijerinckii LMG 2148 T of 93.12% and 92.88% to C. japonicus CECT 7219 T demonstrate that it represents a novel species within the genus Chromohalobacter with additional strains TMW 2.2299 (96.91%) and TMW 2.2304 (96.98%). note 10 emergency calls only

"Web48.2.1 Alpha-Amylases. Alpha-amylases belong to the family of endo -amylases and act on starch to yield glucose and maltose. The first starch-degrading enzyme was discovered … " - Chromohalobacter japonicus

Chromohalobacter japonicus

WebNov 2, 2024 · The fruit extracts of C. japonica (CJ) have been reported to have anticancer activity 22, cardiovascular protection effect 23, and gastroprotective effect via …

Did you know?

WebSep 16, 2024 · T. halophilus, sequencing provided an overview of the microbiota including non-cultured bacteria. The volatile compounds were determined by gas chromatography–mass spectrometry (GC–MS). WebDisclaimer: The NCBI taxonomy database is not an authoritative source for nomenclature or classification - please consult the relevant scientific literature for the most reliable

Chromohalobacter is a gram negative, oxidase and catalase positive, rod shaped, motile marine Pseudomonadota. It is commonly found in marine environments. Two species of Chromohalobacter (Chromohalobacter marismortui and Chromohalobacter salexigens) was isolated from marine sponges of the Saint Martin's Island area of the Bay of Bengal, Bangladesh. WebChromohalobacter japonicus CJ Organism: Chromohalobacter japonicus (g-proteobacteria) Submitter: URMITE Date: 2014/11/19 Assembly type: Assembly level: Contig Genome representation: full GenBank assembly accession: GCA_000821045.1 (replaced) RefSeq assembly accession: GCF_000821045.1 (replaced) IDs: 244271[UID] …

WebGenus Chromohalobacter. Etymology: Chro.mo.ha.lo.bac.ter. Gr. neut. n. chrôma, color; Gr. masc. n. hals (gen. halos), salt; N.L. masc. n. bacter, rod; N.L. masc. n. … WebFeb 12, 2024 · A search in the GenBank database identified benA genes in only two strains of the genus Chromohalobacter: a gene encoding the α‑subunit of benzoate 1,2-DO (EU155151) in Chromohalobacter sp. HS-2 and genes of the α-subunit of benzoate 1,2-DO and benzoate-toluate 1,2-DO (QGTY01000032 and QGTY01000001) in C. salexigens …

Webchildren Name: Chromohalobacter salexigens Arahal et al. 2001 Category: Species Proposed as: sp. nov. Etymology: sal.ex’i.gens. L. masc. n. sal, salt; L. v. exigo, to demand; N.L. part. adj. salexigens, salt-demanding Gender: masculine Type strain: ATCC BAA-138; CCM 4921; CECT 5384; CIP 106854; DSM 3043; NCIMB 13768

WebSep 14, 2024 · The EstSHJ2 was the first reported esterase from Chromohalobacter canadensis, and may carry considerable potential for industrial applications under extreme conditions. ... Chromohalobacter japonicus (MF769788 and OLO11728.1), Halomonas elongata (CBV41603.2), Halomonas caseinilytica (SHK36670.1), Halomonas … how to set clock on westinghouse microwaveWebLactobacillus japonicus Lactobacillus jensenii Lactobacillus jensenii 115-3-CHN Lactobacillus jensenii 1153 Lactobacillus jensenii 208-1 Lactobacillus jensenii 269-3 Lactobacillus jensenii 27-2-CHN Lactobacillus jensenii DSM 20557 Lactobacillus jensenii EX533959VC02 Lactobacillus ... how to set clock on westinghouse oven 665WebChromohalobacter moromii sp. nov., a moderately halophilic bacterium isolated from lupine-based moromi fermentation Syst Appl Microbiol. 2024 Apr 26;45 (4):126324. doi: 10.1016/j.syapm.2024.126324. Online ahead of print. Authors Rebekka H Lülf 1 , Maik Hilgarth 2 , Matthias A Ehrmann 3 Affiliations note 10 charger typeWebSep 25, 2024 · The genus Chromohalobacter is classified within the family Halomonadaceae and the order Oceanospirillales in the class Gammaproteobacteria. … note 10 keyboard languageWebName: Chromohalobacter japonicus Sánchez-Porro et al. 2007 Category: Species Proposed as: sp. nov. Etymology: ja.po’ni.cus. N.L. masc. adj. japonicus, Japanese Gender: masculine Type strain: 43; CCM 7416; CECT 7219 See detailed strain information at Conduct genome-based taxonomy at 16S rRNA gene: AB105159 Analyse FASTA note 10 charger wattWebDec 1, 2024 · It revealed that mostly Tetragenococcus (80.9%) and Halomonadaceae (15.3%) were present in brine A ( Fig. 1 A). In brine C, Tetragenococcus (60.1%) and Halomonadaceae (19.2%) were present too, next to Halanaerobium (17.7%), Chromohalobacter (1.2%), which belongs to the Halomonadaceae family, and … how to set clock on windows 11WebThe proteobacterium Chromohalobacter salexigens can endure some of the widest reported salinity ranges ... 2002) or by L-lysine α-oxidase from Scomber japonicus and … how to set clock on zanussi cooker